PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_95.76
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CO-like
Protein Properties Length: 376aa    MW: 41186.2 Da    PI: 5.9308
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_95.76genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.45.9e-082060438
                     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                                 + C+++++  + lfC+ ++ +lC  C + +H +       H+
  evm.model.supercontig_95.76 20 KPCDTCKSAAAALFCRVDSAFLCLACDSRIH-SlnklasrHE 60
                                 68*****************************.4355555565 PP

2zf-B_box253.9e-0862107342
                     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                   ++C+ +e+ ++   C+ +   lC  C   +H+       H++vp+
  evm.model.supercontig_95.76  62 VWMCEVCEQAPAAVTCKADAAALCVICDADIHSAnplarrHERVPV 107
                                  689*****************************66899999999986 PP

3CCT69.96.6e-24302345144
                          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                  Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  evm.model.supercontig_95.76 302 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 345
                                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.1391764IPR000315B-box-type zinc finger
SMARTSM003361.5E-101764IPR000315B-box-type zinc finger
PfamPF006431.5E-62061IPR000315B-box-type zinc finger
CDDcd000211.60E-82164No hitNo description
PROSITE profilePS5011910.75160107IPR000315B-box-type zinc finger
PfamPF006432.7E-662107IPR000315B-box-type zinc finger
CDDcd000212.35E-963107No hitNo description
SMARTSM003363.3E-1065107IPR000315B-box-type zinc finger
PfamPF062035.9E-18302344IPR010402CCT domain
PROSITE profilePS5101716.817302344IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGIEFQGVKG IAVGWAVTAK PCDTCKSAAA ALFCRVDSAF LCLACDSRIH SLNKLASRHE  60
RVWMCEVCEQ APAAVTCKAD AAALCVICDA DIHSANPLAR RHERVPVEPF FDAAESVIKS  120
TPSTFLMRTD NVTGDYAGAC QHEDVEVGSW LLPNYNLGNS KFNMETDSCV DMKSGDLVFP  180
DMDPFLDFDY HNSFPQHRSS AATDGVAPVQ TKPTPVPVIN NENFFDIEFC RSKLSSFNNQ  240
NQSLSQSVSS SSLDFGVVPD GNSVSDISYN FGRNMSDPSV PVSCINAATT ASQATQLCGI  300
DREARVLRYR EKRKNRKFEK TIRYASRKAY AESRPRIKGR FAKRTEAETD LESNYDSASS  360
TAFMADTPYG VVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007014105.11e-174Zinc finger protein CONSTANS-LIKE 5, putative
SwissprotQ9FHH81e-130COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A061GXB21e-173A0A061GXB2_THECC; Zinc finger protein CONSTANS-LIKE 5, putative
STRINGPOPTR_0018s10510.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-125CONSTANS-like 5